IGF-1 LR3 1mg

IGF-1 LR3 (Long R3-IGF-1) is a highly potent, long-acting analog of human IGF-1 featuring an Arg3 substitution and a 13-residue N-terminal extension that reduces IGFBP binding and extends its half-life. Supplied as a 1 mg vial at 98.7% HPLC purity with a batch-specific third-party Certificate of Analysis. For laboratory and research use only. Not for human consumption. This product is not a drug, supplement, food, or cosmetic and is not intended to diagnose, treat, cure, or prevent any disease.

Research Applications: IGF-1 LR3 is extensively researched for cell proliferation, protein synthesis, and growth factor receptor signaling, supporting advanced investigation into metabolic and regenerative pathways.

Product Specifications - CAS No.: 143045-27-6 / 946870-92-4 | Molecular Formula: C400H625N111O115S9 | Molecular Weight: 9117.6 g/mol | Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA | Purity: 98.7% (HPLC) | Net Content: 1 mg